Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRSS16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | PRSS16 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19155920
![]() |
Novus Biologicals
NBP19155920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191559
![]() |
Novus Biologicals
NBP191559 |
100 μL |
Each for $487.50
|
|
|||||
Description
PRSS16 Polyclonal specifically detects PRSS16 in Human samples. It is validated for Western Blot.Specifications
PRSS16 | |
Polyclonal | |
Rabbit | |
NP_005856 | |
10279 | |
Synthetic peptide directed towards the middle region of human PRSS16. Peptide sequence SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ36271, FLJ44172, protease, serine, 16 (thymus), thymus specific serine peptidase, thymus-specific serine protease | |
PRSS16 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title