NHERF-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191569

Catalog No. NBP191569

Description

NHERF-2 Polyclonal specifically detects NHERF-2 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: NHERF-2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E3KARP, Na(+)/H(+) exchange regulatory cofactor NHE-RF2, NHE3RF2, NHERF2MGC104639, NHERF-2NHE3 kinase A regulatory protein E3KARP, OCTS2, SIP-1SRY-interacting protein 1, sodium/hydrogen exchanger, Sodium-hydrogen exchanger regulatory factor 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatoryfactor 2, solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2, Solute carrier family 9 isoform A3 regulatory factor 2, TKA-1SIP1, Tyrosine kinase activator protein 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9351
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_446263
• Gene Symbols: SLC9A3R2
• Immunogen: Synthetic peptide directed towards the N terminal of human Slc9a3r2. Peptide sequence RLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Pig: 92%; Xenopus: 90%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG