Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A37 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | SLC25A37 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19157020
![]() |
Novus Biologicals
NBP19157020UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191570
![]() |
Novus Biologicals
NBP191570 |
100 μL |
Each for $487.50
|
|
|||||
Description
SLC25A37 Polyclonal specifically detects SLC25A37 in Human samples. It is validated for Western Blot.Specifications
SLC25A37 | |
Polyclonal | |
Rabbit | |
NP_057696 | |
51312 | |
Synthetic peptide directed towards the middle region of human SLC25A37. Peptide sequence RTVYQLNGLAGYFKGIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
PRO1278, solute carrier family 25, member 37 | |
SLC25A37 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title