Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC44A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | SLC44A3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP191571
|
Novus Biologicals
NBP191571 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP1915720
|
Novus Biologicals
NBP19157120UL |
20 μL | N/A | N/A | N/A | ||||
Description
SLC44A3 Polyclonal specifically detects SLC44A3 in Human samples. It is validated for Western Blot.Specifications
| SLC44A3 | |
| Polyclonal | |
| Rabbit | |
| NP_689582 | |
| 126969 | |
| Synthetic peptide directed towards the N terminal of human SLC44A3. Peptide sequence MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| choline transporter-like protein 3, member 3, MGC45474, solute carrier family 44, member 3, UNQ558/PRO1115 | |
| SLC44A3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title