Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NIPA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19158020UL
Description
NIPA2 Polyclonal specifically detects NIPA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NIPA2 | |
Polyclonal | |
Western Blot 1:1000, Immunohistochemistry | |
NP_001008860 | |
NIPA2 | |
Synthetic peptide directed towards the middle region of human NIPA2. Peptide sequence VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
magnesium transporter NIPA2, MGC5466, non imprinted in Prader-Willi/Angelman syndrome 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
81614 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction