Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM200B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TMEM200B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TMEM200B Polyclonal specifically detects TMEM200B in Human samples. It is validated for Western Blot.Specifications
TMEM200B | |
Polyclonal | |
Rabbit | |
NP_001003682 | |
399474 | |
Synthetic peptide directed towards the N terminal of human TTMB. Peptide sequence AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
transmembrane protein 200B | |
TMEM200B | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title