Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALG11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ALG11 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ALG11 Polyclonal specifically detects ALG11 in Human samples. It is validated for Western Blot.Specifications
ALG11 | |
Polyclonal | |
Rabbit | |
NP_001004127 | |
440138 | |
Synthetic peptide directed towards the middle region of human ALG11. Peptide sequence LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast), asparagine-linked glycosylation protein 11 homolog | |
ALG11 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title