Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NIPA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | NIPA2 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP191580
|
Novus Biologicals
NBP191580 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP19158020
|
Novus Biologicals
NBP19158020UL |
20 μL | N/A | N/A | N/A | ||||
Description
NIPA2 Polyclonal specifically detects NIPA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NIPA2 | |
| Unconjugated | |
| RUO | |
| magnesium transporter NIPA2, MGC5466, non imprinted in Prader-Willi/Angelman syndrome 2 | |
| NIPA2 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| NP_001008860 | |
| 81614 | |
| Synthetic peptide directed towards the middle region of human NIPA2. Peptide sequence VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title