Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NIPA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	NIPA2
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP19158020 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP19158020UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP191580 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP191580	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NIPA2 Polyclonal specifically detects NIPA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	NIPA2
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	magnesium transporter NIPA2, MGC5466, non imprinted in Prader-Willi/Angelman syndrome 2
Gene Symbols	NIPA2
Isotype	IgG

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_001008860
Gene ID (Entrez)	81614
Immunogen	Synthetic peptide directed towards the middle region of human NIPA2. Peptide sequence VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NIPA2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents