Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP6AP1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ATP6AP1L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ATP6AP1L Polyclonal specifically detects ATP6AP1L in Human samples. It is validated for Western Blot.Specifications
ATP6AP1L | |
Polyclonal | |
Rabbit | |
NP_001017971 | |
92270 | |
Synthetic peptide directed towards the C terminal of human LOC92270. Peptide sequence LHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ATPase, H+ transporting, lysosomal accessory protein 1-like, MGC138396, vacuolar proton pump subunit S1-like protein, V-type proton ATPase subunit S1-like protein | |
ATP6AP1L | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title