Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™
SDP

Catalog No. p-7110365 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19159020 20 μL
NBP191590 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19159020 Supplier Novus Biologicals Supplier No. NBP19159020UL

Rabbit Polyclonal Antibody

MFSD12 Polyclonal specifically detects MFSD12 in Human samples. It is validated for Western Blot.

Specifications

Antigen MFSD12
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_068377
Gene Alias C19orf28, chromosome 19 open reading frame 28, hypothetical protein LOC126321, major facilitator superfamily domain containing 12, MGC20700, PP3501
Gene Symbols MFSD12
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human C19orf28. Peptide sequence MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSV.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 126321
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.