Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KRTAP11-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KRTAP11-1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KRTAP11-1 Polyclonal specifically detects KRTAP11-1 in Human samples. It is validated for Western Blot.Specifications
KRTAP11-1 | |
Polyclonal | |
Rabbit | |
Human | |
HACL1, HACL-1, high sulfur keratin-associated protein 11.1, KAP11.1, keratin associated protein 11-1, keratin-associated protein 11-1, KRTAP11.1 | |
KRTAP11-1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
NP_787054 | |
337880 | |
Synthetic peptide directed towards the N terminal of human KRTAP11-1. Peptide sequence SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title