Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPPP/p25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19161420UL
Description
TPPP/p25 Polyclonal specifically detects TPPP/p25 in Human, Mouse samples. It is validated for Western Blot.Specifications
| TPPP/p25 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_878259 | |
| TPPP | |
| Synthetic peptide corresponding to a region of Mouse. Peptide sequence TDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQ. | |
| Protein A purified | |
| RUO | |
| 11076 | |
| Store at -20C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| p24, P24,25 kDa brain-specific protein, P25, p25alpha, p25-alpha, TPPP/p25brain specific protein p25 alpha, TPPP1glycogen synthase kinase 3 (GSK3) inhibitor p24, tubulin polymerization promoting protein, tubulin polymerization-promoting protein | |
| Rabbit | |
| 24 kDa | |
| 20 μL | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction