Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPPP/p25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | TPPP/p25 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19161420
|
Novus Biologicals
NBP19161420UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP191614
|
Novus Biologicals
NBP191614 |
100 μL |
Each for $487.50
|
|
|||||
Description
TPPP/p25 Polyclonal specifically detects TPPP/p25 in Human samples. It is validated for Western Blot.Specifications
| TPPP/p25 | |
| Polyclonal | |
| Purified | |
| RUO | |
| p24, P24,25 kDa brain-specific protein, P25, p25alpha, p25-alpha, TPPP/p25brain specific protein p25 alpha, TPPP1glycogen synthase kinase 3 (GSK3) inhibitor p24, tubulin polymerization promoting protein, tubulin polymerization-promoting protein | |
| TPPP | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_878259 | |
| 11076 | |
| Synthetic peptide corresponding to a region of Mouse. Peptide sequence TDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQ. | |
| Primary | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title