Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TPPP/p25 Antibody, Novus Biologicals™

TPPP/p25 Antibody, Novus Biologicals™
SDP

Catalog No. p-7110386 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP191614 100 μL
NBP19161420 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP191614 Supplier Novus Biologicals Supplier No. NBP191614
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TPPP/p25 Polyclonal specifically detects TPPP/p25 in Human samples. It is validated for Western Blot.

Specifications

Antigen TPPP/p25
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_878259
Gene Alias p24, P24,25 kDa brain-specific protein, P25, p25alpha, p25-alpha, TPPP/p25brain specific protein p25 alpha, TPPP1glycogen synthase kinase 3 (GSK3) inhibitor p24, tubulin polymerization promoting protein, tubulin polymerization-promoting protein
Gene Symbols TPPP
Host Species Rabbit
Immunogen Synthetic peptide corresponding to a region of Mouse. Peptide sequence TDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQ.
Molecular Weight of Antigen 24 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11076
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Human: 92%; Chicken: 85%.
Reconstitution Add 100μL of distilled water. Final anti-Tppp antibody concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.