Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tight Junction Protein 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Tight Junction Protein 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB9162120UL
|
Novus Biologicals
NBP19162120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP191621
|
Novus Biologicals
NBP191621 |
100 μL |
Each for $487.50
|
|
|||||
Description
Tight Junction Protein 1 Polyclonal specifically detects Tight Junction Protein 1 in Rat samples. It is validated for Western Blot.Specifications
| Tight Junction Protein 1 | |
| Polyclonal | |
| Rabbit | |
| NP_001099736 | |
| 7082 | |
| Synthetic peptide directed towards ZO-1 tight junction protein. Peptide sequence AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp686M05161, MGC133289, Tight junction protein 1, tight junction protein 1 (zona occludens 1), tight junction protein ZO-1, TJP1, ZO1, ZO-1, zona occludens 1, Zona occludens protein 1, zonula occludens 1 protein, Zonula occludens protein 1 | |
| TJP1 | |
| IgG | |
| 190 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title