ZNF765 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191630

Catalog No. NBP191630

Description

ZNF765 Polyclonal specifically detects ZNF765 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF765
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: zinc finger protein 765
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 91661
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001035275
• Gene Symbols: ZNF765
• Immunogen: The immunogen for this antibody is ZNF765. Peptide sequence CHRRLHTGEKPYKCEECDKAFHFKSKLQIHRRIHTGEKPYKCNECGKTFS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Sumatran orangutan: 90%; Green puffer: 90%; Crab-eating macaque: 90%; Largemouth bass: 90%; Tunicate: 90%; Mosquito: 90%; Body louse: 90%; Rat: 90%; Red flour beetle: 90%; Fruit fly: 90%; Western clawed frog: 90%; Zebrafish: 90%; White-tufted-ear marmoset: 90%; Bovine: 90%; Florida lancelet: 85%; Chicken: 84%; Canine: 84%; Yellowfever mosquito: 84%; African malaria mosquito: 83%; Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
• Isotype: IgG