Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Secretogranin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Secretogranin 3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Secretogranin 3 Polyclonal specifically detects Secretogranin 3 in Mouse samples. It is validated for Western Blot.Specifications
Secretogranin 3 | |
Polyclonal | |
Rabbit | |
NP_001158262 | |
29106 | |
The specific Immunogen is proprietary information. Peptide sequence TGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
secretogranin IIIFLJ90833, secretogranin-3, SgIII | |
SCG3 | |
IgG | |
55 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title