Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WSCD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | WSCD2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
WSCD2 Polyclonal specifically detects WSCD2 in Human samples. It is validated for Western Blot.Specifications
WSCD2 | |
Polyclonal | |
Purified | |
RUO | |
MGC117165, WSC domain containing 2 | |
WSCD2 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
NP_055468 | |
9671 | |
Synthetic peptide directed towards the C terminal of human WSCD2. Peptide sequence GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPR. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title