Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IER3IP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | IER3IP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IER3IP1 Polyclonal specifically detects IER3IP1 in Mouse samples. It is validated for Western Blot.Specifications
IER3IP1 | |
Polyclonal | |
Rabbit | |
NP_079685 | |
51124 | |
Synthetic peptide directed towards the N terminal of human Ier3ip1. Peptide sequence MQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
immediate early response 3 interacting protein 1 | |
IER3IP1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title