Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC35F6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C2orf18 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SLC35F6 Polyclonal specifically detects SLC35F6 in Human samples. It is validated for Western Blot.Specifications
C2orf18 | |
Polyclonal | |
Rabbit | |
NP_060347 | |
54978 | |
Synthetic peptide directed towards the middle region of human C2orf18. Peptide sequence GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ANT2BP, chromosome 2 open reading frame 18 | |
SLC35F6 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title