Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C1orf159/RIVIG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C1orf159/RIVIG |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
C1orf159/RIVIG Polyclonal specifically detects C1orf159/RIVIG in Human samples. It is validated for Western Blot.Specifications
C1orf159/RIVIG | |
Polyclonal | |
Rabbit | |
Human | |
chromosome 1 open reading frame 159, RP11-465B22.4 | |
C1ORF159 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
CAI14318 | |
54991 | |
Synthetic peptide directed towards the C terminal of human C1orf159. Peptide sequence PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title