Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSF5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | HSF5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HSF5 Polyclonal specifically detects HSF5 in Human samples. It is validated for Western Blot.Specifications
HSF5 | |
Polyclonal | |
Rabbit | |
NP_001073908 | |
124535 | |
Synthetic peptide directed towards the middle region of human HSF5. Peptide sequence SKPSEDTGLATPARYREHRSNSQQGKSPDLHLLVDVACKQERFPKEEELK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ40311, heat shock factor protein 5, heat shock transcription factor 5, heat shock transcription factor family member 5, HSF 5, HSTF 5, HSTF5, MGC134827 | |
HSF5 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title