Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UNCX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | UNCX |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
UNCX Polyclonal specifically detects UNCX in Human samples. It is validated for Western Blot.Specifications
UNCX | |
Polyclonal | |
Rabbit | |
NP_001073930 | |
340260 | |
Synthetic peptide directed towards the N terminal of human UNCX. Peptide sequence LLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFTGWQLEELEKA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
homeobox protein unc-4 homolog, homeobox protein Uncx4.1, UNC homeobox | |
UNCX | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title