Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKRD65 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ANKRD65 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ANKRD65 Polyclonal specifically detects ANKRD65 in Human samples. It is validated for Western Blot.Specifications
ANKRD65 | |
Polyclonal | |
Rabbit | |
E5RJM6 | |
441869 | |
Synthetic peptide directed towards the N terminal of human hCG_20426 (XP_497648). Peptide sequence MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVW. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ankyrin repeat domain 65, hypothetical protein LOC441869 | |
ANKRD65 | |
IgG | |
41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title