Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aldolase C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Aldolase C |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Aldolase C Polyclonal specifically detects Aldolase C in Human samples. It is validated for Western Blot.Specifications
Aldolase C | |
Polyclonal | |
Rabbit | |
NP_005156 | |
230 | |
Synthetic peptide directed towards the C terminal of human ALDOC. Peptide sequence CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ALDC, aldolase 3, aldolase C, fructose-bisphosphate, Brain-type aldolase, EC 4.1.2.13, fructoaldolase C, fructose-1,6-biphosphate triosephosphate lyase, fructose-bisphosphate aldolase C | |
ALDOC | |
IgG | |
39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title