TEAD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182386

Catalog No. NBP182386

Description

TEAD4 Polyclonal specifically detects TEAD4 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: TEAD4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EFTR-2, hRTEF-1B, related transcription enhancer factor 1B, RTEF1RTEF-1, TCF13L1MGC9014, TEA domain family member 4TEF3, TEAD-4, TEF-3, TEFR-1, Transcription factor 13-like 1, Transcription factor RTEF-1, transcriptional enhancer factor 1-related, transcriptional enhancer factor 3, transcriptional enhancer factor TEF-3
• Host Species: Rabbit
• Molecular Weight of Antigen: 48 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_035697
• Gene Symbols: TEAD4
• Immunogen: Synthetic peptide towards Tead4. Peptide sequence RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7004
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.