Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR45L Antibody, Novus Biologicals™
SDP

Catalog No. NBP18238720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18238720 20 μL
NBP182387 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18238720 Supplier Novus Biologicals Supplier No. NBP18238720UL

Rabbit Polyclonal Antibody

WDR45L Polyclonal specifically detects WDR45L in Human, Rat samples. It is validated for Western Blot.

Specifications

Antigen WDR45L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_001034676
Gene Alias WDR45-like, WDR45-like protein, WIPI3
Gene Symbols WDR45L
Host Species Rabbit
Immunogen Synthetic peptide towards Wdr45l. Peptide sequence YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV.
Molecular Weight of Antigen 37 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56270
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.