Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR45L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18238720UL
Description
WDR45L Polyclonal specifically detects WDR45L in Human, Rat samples. It is validated for Western Blot.Specifications
WDR45L | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001034676 | |
WDR45L | |
Synthetic peptide towards Wdr45l. Peptide sequence YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV. | |
Affinity Purified | |
RUO | |
56270 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
WDR45-like, WDR45-like protein, WIPI3 | |
Rabbit | |
37 kDa | |
20 μL | |
Primary | |
Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction