Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR45L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | WDR45L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18238720
![]() |
Novus Biologicals
NBP18238720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP182387
![]() |
Novus Biologicals
NBP182387 |
100 μL |
Each for $487.50
|
|
|||||
Description
WDR45L Polyclonal specifically detects WDR45L in Human, Rat samples. It is validated for Western Blot.Specifications
WDR45L | |
Polyclonal | |
Rabbit | |
NP_001034676 | |
56270 | |
Synthetic peptide towards Wdr45l. Peptide sequence YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
WDR45-like, WDR45-like protein, WIPI3 | |
WDR45L | |
IgG | |
37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title