Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UGT1A5 Antibody, Novus Biologicals™

UGT1A5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19133620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19133620 20 μL
NBP191336 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19133620 Supplier Novus Biologicals Supplier No. NBP19133620UL

Description

Rabbit Polyclonal Antibody

UGT1A5 Polyclonal specifically detects UGT1A5 in Human samples. It is validated for Western Blot.

Specifications

Antigen UGT1A5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_061951
Gene Alias GNT1, polypeptide A5, UDP glucuronosyltransferase 1 family, polypeptide A5, UDP-glucuronosyltransferase 1-E, UDPGT 1-5, UGT1, UGT1*5, UGT1E, UGT-1E
Gene Symbols UGT1A5
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human UGT1A5. Peptide sequence EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54579
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.