Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TTYH3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19135020UL
Description
TTYH3 Polyclonal specifically detects TTYH3 in Human samples. It is validated for Western Blot.Specifications
TTYH3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_079526 | |
TTYH3 | |
Synthetic peptide directed towards the middle region of human TTYH3. Peptide sequence IIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA. | |
Affinity Purified | |
RUO | |
80727 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
hTTY3, KIAA1691, protein tweety homolog 3, tweety homolog 3 (Drosophila) | |
Rabbit | |
57 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction