Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ISLR-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | ISLR-2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ISLR-2 Polyclonal specifically detects ISLR-2 in Human samples. It is validated for Western Blot.Specifications
ISLR-2 | |
Polyclonal | |
Rabbit | |
NP_065902 | |
57611 | |
Synthetic peptide directed towards the N terminal of human ISLR2. Peptide sequence PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
immunoglobulin superfamily containing leucine-rich repeat 2, KIAA1465, leucine-rich repeat domain and immunoglobulin domain-containing axon extension protein, LINX, UNQ1885/PRO4329 | |
ISLR2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title