Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
xylosyltransferase 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | xylosyltransferase 1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19134520
![]() |
Novus Biologicals
NBP19134520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191345
![]() |
Novus Biologicals
NBP191345 |
100 μL |
Each for $487.50
|
|
|||||
Description
xylosyltransferase 1 Polyclonal specifically detects xylosyltransferase 1 in Human samples. It is validated for Western Blot.Specifications
xylosyltransferase 1 | |
Polyclonal | |
Rabbit | |
NP_071449 | |
64131 | |
Synthetic peptide directed towards the middle region of human XYLT1. Peptide sequence RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
beta-D-xylosyltransferase 1, O-xylosyltransferase 1, peptide O-xylosyltransferase 1, PXYLT1, XT1, xylosyltransferase 1, xylosyltransferase I, xylT-I | |
XYLT1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title