Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SALM4/LRFN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | SALM4/LRFN3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SALM4/LRFN3 Polyclonal specifically detects SALM4/LRFN3 in Human samples. It is validated for Western Blot.Specifications
SALM4/LRFN3 | |
Polyclonal | |
Rabbit | |
NP_078785 | |
79414 | |
Synthetic peptide directed towards the C terminal of human LRFN3. Peptide sequence VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
fibronectin type III, immunoglobulin and leucine rich repeat domains 1, FIGLER1, leucine rich repeat and fibronectin type III domain containing 3, leucine-rich repeat and fibronectin type-III domain-containing protein 3, MGC2656, SALM4, synaptic adhesion-like molecule 4, UNQ5865/PRO34192 | |
LRFN3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title