Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TTYH3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | TTYH3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19135020
|
Novus Biologicals
NBP19135020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP191350
|
Novus Biologicals
NBP191350 |
100 μL |
Each for $487.50
|
|
|||||
Description
TTYH3 Polyclonal specifically detects TTYH3 in Human samples. It is validated for Western Blot.Specifications
| TTYH3 | |
| Polyclonal | |
| Rabbit | |
| NP_079526 | |
| 80727 | |
| Synthetic peptide directed towards the middle region of human TTYH3. Peptide sequence IIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| hTTY3, KIAA1691, protein tweety homolog 3, tweety homolog 3 (Drosophila) | |
| TTYH3 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title