Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19135720UL
Description
FAR1 Polyclonal specifically detects FAR1 in Human samples. It is validated for Western Blot.Specifications
FAR1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_115604 | |
FAR1 | |
Synthetic peptide directed towards the N terminal of human MLSTD2. Peptide sequence LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII. | |
20 μL | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
fatty acyl CoA reductase 1, FLJ22728, FLJ33561, short chain dehydrogenase/reductase family 10E, member 1, UNQ2423/PRO4981 | |
Rabbit | |
Protein A purified | |
RUO | |
84188 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction