Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAR1 Antibody, Novus Biologicals™

FAR1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19135720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19135720 20 μL
NBP191357 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19135720 Supplier Novus Biologicals Supplier No. NBP19135720UL

Description

Rabbit Polyclonal Antibody

FAR1 Polyclonal specifically detects FAR1 in Human samples. It is validated for Western Blot.

Specifications

Antigen FAR1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_115604
Gene Alias fatty acyl CoA reductase 1, FLJ22728, FLJ33561, short chain dehydrogenase/reductase family 10E, member 1, UNQ2423/PRO4981
Gene Symbols FAR1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human MLSTD2. Peptide sequence LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84188
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.