Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SGPP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
$499.50
Specifications
Antigen | SGPP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SGPP1 Polyclonal specifically detects SGPP1 in Human, Mouse samples. It is validated for Western Blot.Specifications
SGPP1 | |
Polyclonal | |
Rabbit | |
NP_110418 | |
81537 | |
Synthetic peptide directed towards the middle region of human SGPP1. Peptide sequence THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
sphingosine-1-phosphate phosphatase 1 | |
SGPP1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title