Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ESYT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | ESYT3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19135520
![]() |
Novus Biologicals
NBP19135520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191355
![]() |
Novus Biologicals
NBP191355 |
100 μL |
Each for $499.50
|
|
|||||
Description
ESYT3 Polyclonal specifically detects ESYT3 in Human samples. It is validated for Western Blot.Specifications
ESYT3 | |
Polyclonal | |
Rabbit | |
NP_114119 | |
83850 | |
Synthetic peptide directed towards the middle region of human FAM62C. Peptide sequence EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chr3 synaptotagmin, CHR3SYT, extended synaptotagmin-like protein 3, member C | |
ESYT3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title