Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | FAR1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP191357
|
Novus Biologicals
NBP191357 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP19135720
|
Novus Biologicals
NBP19135720UL |
20 μL | N/A | N/A | N/A | ||||
Description
FAR1 Polyclonal specifically detects FAR1 in Human samples. It is validated for Western Blot.Specifications
| FAR1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| fatty acyl CoA reductase 1, FLJ22728, FLJ33561, short chain dehydrogenase/reductase family 10E, member 1, UNQ2423/PRO4981 | |
| FAR1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_115604 | |
| 84188 | |
| Synthetic peptide directed towards the N terminal of human MLSTD2. Peptide sequence LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title