Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF823 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen ZNF823
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP191372
SDP
View Documents
Novus Biologicals
NBP191372
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

ZNF823 Polyclonal specifically detects ZNF823 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF823
Polyclonal
Purified
RUO
NP_001073962
55552
Synthetic peptide directed towards the N terminal of human HSZFP36. Peptide sequence GECGEVVLGHSSLNCNIRVDTGHKSCEHQEYGEKPYTHKQRGKAISHQHS.
Primary
Western Blot
Unconjugated
Rabbit
Human
HSZFP36, ZFP 36 for a zinc finger protein, ZFP36, ZFP-36 for a zinc finger protein, zinc finger protein 823, zinc finger protein ZFP-36
ZNF823
IgG
Protein A purified
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.