Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NLRP5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169159 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169159 100 μL
NBP16915920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP169159 Supplier Novus Biologicals Supplier No. NBP169159
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

NLRP5 Polyclonal specifically detects NLRP5 in Human samples. It is validated for Western Blot.

Specifications

Antigen NLRP5
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P59047
Gene Alias CLR19.8, MATERMater protein homolog, NACHT, leucine rich repeat and PYD containing 5, NACHT, LRR and PYD domains-containing protein 5, NALP5maternal antigen that embryos require, NLR family, pyrin domain containing 5, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 5, PAN11, PYPAF8
Gene Symbols NLRP5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NLRP5 (NLR family, pyrin domain containing 5) The peptide sequence was selected from the N terminal of NLRP5. Peptide sequence LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPG.
Molecular Weight of Antigen 134 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Stem Cell Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 126206
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.