Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NM23-H1 Antibody, Novus Biologicals™
SDP

Catalog No. p-200038816 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB434000 25ul
NBP180992 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB434000 Supplier Novus Biologicals Supplier No. NBP18099225UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 2 publications

NM23-H1 Polyclonal specifically detects NM23-H1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen NME1-NME2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P15531, P15531, P15531, P15531
Gene Alias C-myc purine-binding transcription factor PUF, EC 2.7.13.3, EC 2.7.4.6, FLJ93990, Histidine protein kinase NDKB, NDK B, NDP kinase B, NM23B, nm23-H2, NM23-LV, NME1-NME2 protein, NME1-NME2 readthrough, NME1-NME2 readthrough transcript, NMELV
Gene Symbols NME1-NME2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 654364
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Rat, Mouse, Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.