NM23-H1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Catalog Number	Mfr. No.	Quantity
NB434000	Novus Biologicals NBP18099225UL	25ul
NBP180992	Novus Biologicals NBP180992	0.1 mL

Description

NM23-H1 Polyclonal specifically detects NM23-H1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NME1-NME2
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C-myc purine-binding transcription factor PUF, EC 2.7.13.3, EC 2.7.4.6, FLJ93990, Histidine protein kinase NDKB, NDK B, NDP kinase B, NM23B, nm23-H2, NM23-LV, NME1-NME2 protein, NME1-NME2 readthrough, NME1-NME2 readthrough transcript, NMELV
• Gene Symbols: NME1-NME2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Rat, Mouse, Human
• Gene Accession No.: P15531, P15531, P15531, P15531
• Gene ID (Entrez): 654364
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only