Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NMDAR2A Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310351100UL
Description
NMDAR2A Polyclonal specifically detects NMDAR2A in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry.Specifications
NMDAR2A | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
GluN2A, glutamate receptor, ionotropic, N-methyl D-aspartate 2A, hNR2A, NMDA receptor subtype 2A, N-methyl D-aspartate receptor subtype 2A, N-methyl-D-aspartate receptor subunit 2A, subunit epsilon-1 | |
The immunogen is a synthetic peptide directed towards the middle region of human NMDAR2A (NP_000824). Peptide sequence DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST | |
100 μg | |
Neuroendocrinology, Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision | |
2903 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Rat | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction