Abnova™ NME2 Recombinant Protein

Supplier:  Abnova™ H00004831P0125

Catalog No. 89-010-325

Description

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product.

• Human NME2 full-length ORF ( AAH02476, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal
• Gene description: protein (NM23B) expressed in non-metastatic cells 2
• Theoretical molecular weight: 42.46kDa
• Preparation method: in vitro wheat germ expression system
• Purification: glutathione sepharose 4 fast flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer

Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Best use within three months from the date of receipt.

ELISA, western blotting (recombinant protein), antibody production, protein array

Specifications

• Accession Number: AAH02476
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Molecular Weight (g/mol): 42.46
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 25 ug
• Immunogen: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
• Gene Alias: MGC111212/NDPK-B/NDPKB/NM23-H2/NM23B/puf
• Gene Symbol: NME2
• Species: Wheat Germ (in vitro)
• Protein Tag: GST

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 4831
• Name: NME2 (Human) Recombinant Protein (P01)
• Preparation Method: In vitro wheat germ expression system
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Source: Wheat Germ (in vitro)
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: NME2
• Cross Reactivity: Human
• Recombinant: Recombinant
• Form: Solution