Learn More
Abnova™ NME2 Recombinant Protein
Shop All Abnova Corporation ProductsDescription
Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product.
- Human NME2 full-length ORF ( AAH02476, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal
- Gene description: protein (NM23B) expressed in non-metastatic cells 2
- Theoretical molecular weight: 42.46kDa
- Preparation method: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Specifications
Specifications
Accession Number | AAH02476 |
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 4831 |
Molecular Weight (g/mol) | 42.46 |
Name | NME2 (Human) Recombinant Protein (P01) |
pH Range | 8 |
Preparation Method | In vitro wheat germ expression system |
Purification Method | Glutathione Sepharose 4 Fast Flow |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.