Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NMRAL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$501.50
Specifications
Antigen | NMRAL1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NMRAL1 Polyclonal specifically detects NMRAL1 in Human samples. It is validated for Western Blot.Specifications
NMRAL1 | |
Polyclonal | |
Rabbit | |
Q9HBL8 | |
57407 | |
Synthetic peptides corresponding to NMRAL1(NmrA-like family domain containing 1) The peptide sequence was selected from the middle region of NMRAL1. Peptide sequence TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
HSCARGFLJ25918, NmrA-like family domain containing 1, nmrA-like family domain-containing protein 1, SDR48A1, short chain dehydrogenase/reductase family 48A, member 1 | |
NMRAL1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title