Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NNT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NNT |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NNT Polyclonal specifically detects NNT in Human samples. It is validated for Western Blot.Specifications
NNT | |
Polyclonal | |
Rabbit | |
Q13423 | |
23530 | |
Synthetic peptides corresponding to NNT(nicotinamide nucleotide transhydrogenase) The peptide sequence was selected from the N terminal of NNT. Peptide sequence IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC126502, mitochondrial, nicotinamide nucleotide transhydrogenaseMGC126503, Pyridine nucleotide transhydrogenase | |
NNT | |
IgG | |
114 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title