Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NO66 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen NO66
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124846
View Documents
Novus Biologicals
NBP30997225UL
25 μg N/A
NB124845
View Documents
Novus Biologicals
NBP309972100UL
100 μg N/A
Description

Description

NO66 Polyclonal antibody specifically detects NO66 in Human samples. It is validated for Western Blot
Specifications

Specifications

NO66
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
79697
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
chromosome 14 open reading frame 169, EC 1.14.11.27, FLJ21802, hsNO66, MAPJD, MYC-associated protein with JmjC domain, NO66lysine-specific demethylase NO66, Nucleolar protein 66
The immunogen is a synthetic peptide directed towards the middle region of Human NO66. Peptide sequence EAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVR
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit