Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NOB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	NOB1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP155404 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155404	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NOB1 Polyclonal specifically detects NOB1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	NOB1
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9ULX3
Gene ID (Entrez)	28987
Immunogen	Synthetic peptides corresponding to NOB1(NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of NOB1. Peptide sequence TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	adenocarcinoma antigen recognized by T lymphocytes 4, ART4, ART-4, MST158, nin one binding protein, NIN1/RPN12 binding protein 1 homolog (S. cerevisiae), NOB1PPSMD8BP1, Phosphorylation regulatory protein HP-10, Protein ART-4, PSMD8 binding protein 1, RNA-binding protein NOB1
Gene Symbols	NOB1
Isotype	IgG
Molecular Weight of Antigen	47 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NOB1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents