Nogo Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169284

Catalog No. NBP169284

Description

Nogo Polyclonal specifically detects Nogo in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Nogo
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ASY, foocen, Human NogoA, KIAA0886, My043 protein, Nbla00271, Nbla10545, neurite growth inhibitor 220, Neurite outgrowth inhibitor, Neuroendocrine-specific protein, Neuroendocrine-specific protein C homolog, NI220/250, Nogo protein, NOGO-A, Nogo-B, Nogo-C, NOGOC, NOGORTN4-B1, NSP, NSP-CL, reticulon 4, reticulon 5, reticulon-4, reticulon-5, RTN4-A, RTN4-B2, RTN4-C, RTN-x
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 57142
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7L7Q5
• Gene Symbols: RTN4
• Immunogen: Synthetic peptides corresponding to Nogo The peptide sequence was selected from the middle region of Nogo. Peptide sequence RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only