Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579748

Invitrogen™ NONO Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579748
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579748 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579748 Supplier Invitrogen™ Supplier No. PA579748
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A549 whole cell, human SW620 whole cell, human PANC-1 whole cell, human U20S whole cell, rat lung tissue, mouse lung tissue. IHC: mouse brain tissue, human lung cancer tissue, human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue, rat intestine tissue. ICC/IF: U20S cell, SKOV-3 cell. Flow: HELA cell.

This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NONO
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Nono
Gene Accession No. Q15233, Q5FVM4, Q99K48
Gene Alias 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; AA407051; AV149256; DNA-binding p52/p100 complex, 52 kDa subunit; HGNC:7871; LOC100346936; MRXS34; NMT-1; NMT55; nonA; Nono; NonO protein; non-POU domain containing octamer binding; non-POU domain containing, octamer-binding; non-POU domain-containing octamer (ATGCAAAT) binding protein; non-POU domain-containing octamer-binding protein; non-POU-domain-containing; non-POU-domain-containing, octamer binding protein; non-POU-domain-containing, octamer-binding protein; NRB54; P54; p54(nrb); p54nrb; PPP1R114; protein phosphatase 1, regulatory subunit 114
Gene Symbols Nono
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 317259, 4841, 53610
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.