Invitrogen™ NONO Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579748

Catalog No. PIPA579748

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A549 whole cell, human SW620 whole cell, human PANC-1 whole cell, human U20S whole cell, rat lung tissue, mouse lung tissue. IHC: mouse brain tissue, human lung cancer tissue, human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue, rat intestine tissue. ICC/IF: U20S cell, SKOV-3 cell. Flow: HELA cell.

This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.

Specifications

• Antigen: NONO
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Nono
• Gene Alias: 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; AA407051; AV149256; DNA-binding p52/p100 complex, 52 kDa subunit; HGNC:7871; LOC100346936; MRXS34; NMT-1; NMT55; nonA; Nono; NonO protein; non-POU domain containing octamer binding; non-POU domain containing, octamer-binding; non-POU domain-containing octamer (ATGCAAAT) binding protein; non-POU domain-containing octamer-binding protein; non-POU-domain-containing; non-POU-domain-containing, octamer binding protein; non-POU-domain-containing, octamer-binding protein; NRB54; P54; p54(nrb); p54nrb; PPP1R114; protein phosphatase 1, regulatory subunit 114
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 317259, 4841, 53610
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5 mg BSA and 0.05 mg sodium azide
• Gene Accession No.: Q15233, Q5FVM4, Q99K48
• Gene Symbols: Nono
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov