NOP14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21366525UL

Catalog No. NB438370

Description

NOP14 Polyclonal specifically detects NOP14 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: NOP14
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated
• Gene Alias: C4orf9, chromosome 4 open reading frame 9, NOL14nucleolar protein 14 homolog (yeast), NOP14 homolog, NOP14 nucleolar protein homolog (yeast), Nucleolar complex protein 14, nucleolar protein 14, nucleolar protein 14 homolog, probable nucleolar complex protein 14, RES425, RES4-25
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8602
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NOP14
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: REKPKSRKELIEELIAKSKQEKRERQAQREDALELTEKLDQDWKEIQTLLSHKTPKSENRDKKEKPKPDAYDMMVRELGFEMKAQPSNRMKT
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only