Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOP9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | NOP9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NOP9 Polyclonal specifically detects NOP9 in Human samples. It is validated for Western Blot.Specifications
NOP9 | |
Polyclonal | |
Rabbit | |
NP_777573 | |
161424 | |
Synthetic peptide directed towards the middle region of human C14orf21. Peptide sequence GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C14orf21, chromosome 14 open reading frame 21, KIAA2021, pumilio domain-containing protein C14orf21 | |
NOP9 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title